PCK1 Rabbit Polyclonal Antibody

CAT#: TA331174

Rabbit Polyclonal Anti-PCK1 Antibody

Product Images

WB Suggested Anti-PCK1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Jurkat cell lysate

• 

  Host: Rabbit; Target Name: PCK1; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: PCK1; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: PCK1; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: PCK1; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: PCK1; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0ug/ml

• Host: Rabbit; Target Name: PCK1; Sample Tissue: MCF7; Antibody Dilution: 1.0ug/ml

• WB Suggested Anti-PCK1 Antibody ; Positive Control: Lane 1: 80ug pig serum; Primary Antibody Dilution : 1:1000; Secondary Antibody : Anti-rabbit-HRP; Secondry Antibody Dilution : 1:1000; Submitted by: Martina Ondrovics, University of Veterinary Medicine V

• WB Suggested Anti-PCK1 Antibody ; Positive Control: Lane 1: 80ug pig serum protein; Primary Antibody Dilution : 1:1000; Secondary Antibody : Anti-rabbit-HRP; Secondry Antibody Dilution : 1:500; Submitted by: Martina Ondrovics, University of Veterinary Med

Show all 9 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Pig
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 69 kDa
• Gene Name: phosphoenolpyruvate carboxykinase 1
• Database Link:
  NP_002582
  Entrez Gene 5105 Human
  UniProt ID P35558
• Background: PCK1 is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of PCK1 can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet.This gene is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of this gene can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet. Defects in this gene are a cause of cytosolic phosphoenolpyruvate carboxykinase deficiency. A mitochondrial isozyme of the encoded protein also has been characterized. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: PEPCK-C; PEPCK1; PEPCKC
• Note: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 93%; Rabbit: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Adipocytokine signaling pathway, Citrate cycle (TCA cycle), Glycolysis / Gluconeogenesis, Insulin signaling pathway, Metabolic pathways, PPAR signaling pathway, Pyruvate metabolism