ALF (GTF2A1L) Rabbit Polyclonal Antibody

CAT#: TA331190

Rabbit Polyclonal Anti-ALF Antibody

Product Images

WB Suggested Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ALF antibody: synthetic peptide directed towards the N terminal of human ALF. Synthetic peptide located within the following region: VIPAGRTLPSFTTAELGTSNSSANFTFPGYPIHVPAGVTLQTVSGHLYKV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: general transcription factor IIA subunit 1 like
• Database Link:
  NP_006863
  Entrez Gene 11036 Human
  UniProt ID Q9UNN4
• Background: The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involve the effects of TFIIA on the interaction between TATA-binding protein (TBP) and DNA. This gene encodes a germ cell-specific counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the binding of TBP to DNA and may be uniquely important to testis biology.
• Synonyms: ALF
• Note: Rat: 100%; Horse: 100%; Human: 100%; Dog: 92%; Bovine: 92%; Rabbit: 91%; Pig: 83%; Guinea pig: 83%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Basal transcription factors