FLVCR2 Rabbit Polyclonal Antibody

CAT#: TA331253

Rabbit Polyclonal Anti-FLVCR2 Antibody

Product Images

WB Suggested Anti-FLVCR2 Antibody; Titration: 1.0 ug/ml; Positive Control: HT1080 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FLVCR2 antibody is: synthetic peptide directed towards the C-terminal region of Human FLVCR2. Synthetic peptide located within the following region: TLLNRMVIWHYPGEEVNAGRIGLTIVIAGMLGAVISGIWLDRSKTYKETT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: feline leukemia virus subgroup C cellular receptor family member 2
• Database Link:
  NP_060261
  Entrez Gene 55640 Human
  UniProt ID Q9UPI3
• Background: This gene encodes a member of the major facilitator superfamily. The encoded transmembrane protein is a calcium transporter. Unlike the related protein feline leukemia virus subgroup C receptor 1, the protein encoded by this locus does not bind to feline leukemia virus subgroup C envelope protein. The encoded protein may play a role in development of brain vascular endothelial cells, as mutations at this locus have been associated with proliferative vasculopathy and hydranencephaly-hydrocephaly syndrome. Alternatively spliced transcript variants have been described.
• Synonyms: C14orf58; CCT; EPV; FLVCRL14q; MFSD7C; PVHH
• Note: Dog: 100%; Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 93%; Horse: 86%

Reference Data

• Protein Families: Transmembrane