Nefm Rabbit Polyclonal Antibody

CAT#: TA331276

Rabbit Polyclonal Anti-Nefm Antibody

Product Images

Host: Rabbit; Target Name: Nefm; Sample Tissue: Rat Muscle lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Nefm antibody is: synthetic peptide directed towards the C-terminal region of Rat Nefm. Synthetic peptide located within the following region: GGDGATKYITKSVTVTQKVEEHEETFEEKLVSTKKVEKVTSHAIVKEVTQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 92 kDa
• Gene Name: neurofilament, medium polypeptide
• Database Link:
  NP_058725
  Entrez Gene 24588 Rat
  UniProt ID P12839
• Background: Nefm is a neuronal intermediate filament protein and an important component of the cytoskeleton.
• Synonyms: NEF3; NF-M; NFM
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%