TIGIT Rabbit Polyclonal Antibody

CAT#: TA331300

Rabbit Polyclonal Anti-TIGIT Antibody

Product Images

WB Suggested Anti-TIGIT Antibody; Titration: 1.0 ug/ml; Positive Control: HepG2 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TIGIT antibody is: synthetic peptide directed towards the C-terminal region of Human TIGIT. Synthetic peptide located within the following region: ALRIHSVEGDLRRKSAGQEEWSPSAPSPPGSCVQAEAAPAGLCGEQRGED
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: T-cell immunoreceptor with Ig and ITIM domains
• Database Link:
  NP_776160
  Entrez Gene 201633 Human
  UniProt ID Q495A1
• Background: This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high affinity; this binding is thought to assist interactions between TFH and dendritic cells to regulate T cell dependent B cell responses.
• Synonyms: VSIG9; VSTM3; WUCAM
• Note: Human: 100%

Reference Data

• Protein Families: Transmembrane