CXorf40A Rabbit Polyclonal Antibody

CAT#: TA331320

Rabbit Polyclonal Anti-CXorf40A Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "CXorf40A"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-CXorf40A antibody is: synthetic peptide directed towards the C-terminal region of Human CXorf40A. Synthetic peptide located within the following region: EDLTPDEVVELENQAVLTNLKQKYLTVISNPRWLLEPIPRKGGKDVFQVD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 17 kDa
Gene Name chromosome X open reading frame 40A
Background CXorf40A may have an important role of cell protection in inflammation reaction.
Synonyms CXorf40; EOLA1; FLJ16423
Note Horse: 100%; Human: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Pig: 79%; Rabbit: 79%; Guinea pig: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.