CXorf40A Rabbit Polyclonal Antibody

CAT#: TA331320

Rabbit Polyclonal Anti-CXorf40A Antibody

Product Images

WB Suggested Anti-CXorf40A Antibody; Titration: 1.0 ug/ml; Positive Control: MCF7 Whole CellCXorf40A is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CXorf40A antibody is: synthetic peptide directed towards the C-terminal region of Human CXorf40A. Synthetic peptide located within the following region: EDLTPDEVVELENQAVLTNLKQKYLTVISNPRWLLEPIPRKGGKDVFQVD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 17 kDa
• Gene Name: chromosome X open reading frame 40A
• Database Link:
  NP_835225
  Entrez Gene 91966 Human
  UniProt ID Q8TE69
• Background: CXorf40A may have an important role of cell protection in inflammation reaction.
• Synonyms: CXorf40; EOLA1; FLJ16423
• Note: Horse: 100%; Human: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Pig: 79%; Rabbit: 79%; Guinea pig: 79%