D2HGDH Rabbit Polyclonal Antibody

CAT#: TA331321

Rabbit Polyclonal Anti-D2HGDH Antibody


USD 375.00

2 Weeks*

Size
    • 100 ul

Product Images

Other products for "D2HGDH"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-D2HGDH antibody is: synthetic peptide directed towards the C-terminal region of Human D2HGDH. Synthetic peptide located within the following region: QESPFYVLIETSGSNAGHDAEKLGHFLEHALGSGLVTDGTMATDQRKVKM
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 55 kDa
Gene Name D-2-hydroxyglutarate dehydrogenase
Background This gene encodes D-2hydroxyglutarate dehydrogenase, a mitochondrial enzyme belonging to the FAD-binding oxidoreductase/transferase type 4 family. This enzyme, which is most active in liver and kidney but also active in heart and brain, converts D-2-hydroxyglutarate to 2-ketoglutarate. Mutations in this gene are present in D-2-hydroxyglutaric aciduria, a rare recessive neurometabolic disorder causing developmental delay, epilepsy, hypotonia, and dysmorphic features.
Synonyms D2HGD
Note Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 92%; Horse: 86%; Dog: 79%; Pig: 77%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.