D2HGDH Rabbit Polyclonal Antibody

CAT#: TA331322

Rabbit Polyclonal Anti-D2HGDH Antibody

Product Images

Host: Rabbit; Target Name: D2HGDH; Sample Tissue: 293T Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-D2HGDH antibody is: synthetic peptide directed towards the N-terminal region of Human D2HGDH. Synthetic peptide located within the following region: AFERIVPGGVVTDPEALQAPNVDWLRTLRGCSKVLLRPRTSEEVSHILRH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: D-2-hydroxyglutarate dehydrogenase
• Database Link:
  NP_689996
  Entrez Gene 728294 Human
  UniProt ID Q8N465
• Background: The function of this protein remains unknown.
• Synonyms: D2HGD
• Note: Human: 100%; Rat: 93%; Dog: 92%; Rabbit: 92%; Mouse: 86%; Pig: 85%; Guinea pig: 85%; Horse: 79%; Bovine: 79%; Zebrafish: 77%