GPR58 (TAAR2) Rabbit Polyclonal Antibody

CAT#: TA331363

Rabbit Polyclonal Anti-TAAR2 Antibody

Product Images

WB Suggested Anti-TAAR2 Antibody; Titration: 1.0 ug/ml; Positive Control: Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TAAR2 antibody is: synthetic peptide directed towards the C-terminal region of Human TAAR2. Synthetic peptide located within the following region: ENQNNQVKKDKKAAKTLGIVIGVFLLCWFPCFFTILLDPFLNFSTPVVLF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: trace amine associated receptor 2
• Database Link:
  NP_055441
  Entrez Gene 9287 Human
  UniProt ID Q9P1P5
• Background: TAAR2 is an orphan receptor.
• Synonyms: GPR58; taR-2
• Note: Human: 100%; Pig: 86%; Rat: 86%; Mouse: 86%; Bovine: 86%; Horse: 79%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction