C16orf65 (PDZD9) Rabbit Polyclonal Antibody

CAT#: TA331415

Rabbit polyclonal Anti-C16orf65 Antibody

Product Images

WB Suggested Anti-C16orf65 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: Human Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C16orf65 antibody: synthetic peptide directed towards the middle region of human C16orf65. Synthetic peptide located within the following region: TSTPKKIELAKDESFTSSDDNENVDLDKRLQYYRYPWSTVHHPARRPISI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: PDZ domain containing 9
• Database Link:
  NP_776167
  Entrez Gene 255762 Human
  UniProt ID Q8IXQ8
• Background: The specific function of the protein remains unknown.
• Synonyms: C16orf65
• Note: Human: 100%; Rabbit: 92%; Dog: 77%; Rat: 77%