Tbpl2 Rabbit Polyclonal Antibody

CAT#: TA331442

Rabbit polyclonal Anti-TRF3 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Tbpl2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TRF3 antibody: synthetic peptide directed towards the N terminal of mouse TRF3. Synthetic peptide located within the following region: FHPHLGGVKKASTDFSSVDLSFLPDELTQENRDQTVTGNKLASEESCRTR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 39 kDa
Gene Name TATA box binding protein like 2
Background TRF3 is a nuclear protein that is present in all human and mouse tissues and cell lines examined.
Synonyms TBP2; TRF3
Note Rat: 100%; Mouse: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.