GRIK5 Rabbit Polyclonal Antibody

CAT#: TA331454

Rabbit polyclonal Anti-GRIK5 Antibody

Product Images

WB Suggested Anti-GRIK5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:2500; Positive Control: Jurkat cell lysateGRIK5 is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Rabbit Anti-GRIK5 Antibody; Catalog Number: ARP37674_P050; Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue; Observed Staining: Membrane in cell processes; Primary Antibody Concentration: 1:100; Other Working Concentrations: 1/600; Secondary A

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GRIK5 antibody: synthetic peptide directed towards the middle region of human GRIK5. Synthetic peptide located within the following region: EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 108 kDa
• Gene Name: glutamate ionotropic receptor kainate type subunit 5
• Database Link:
  NP_002079
  Entrez Gene 2901 Human
  UniProt ID Q16478
• Background: GRIK5 is a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. GRIK5 forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members.This gene encodes a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. The protein encoded by this gene forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: EAA2; GluK5; GRIK2; KA2
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Glutamate Receptors, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction