ACCN5 (ASIC5) Rabbit Polyclonal Antibody

CAT#: TA331464

Rabbit polyclonal Anti-ACCN5 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ASIC5"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ACCN5 antibody: synthetic peptide directed towards the middle region of human ACCN5. Synthetic peptide located within the following region: FTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGFVD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 56 kDa
Gene Name acid sensing ion channel subunit family member 5
Background ACCN5 belongs to the amiloride-sensitive Na+ channel and degenerin (NaC/DEG) family, members of which have been identified in many animal species ranging from the nematode to human. The amiloride-sensitive Na(+) channel encoded by this gene is primarily expressed in the small intestine, however, its exact function is not known.
Synonyms ACCN5; HINAC; INAC
Note Human: 100%; Horse: 79%
Reference Data
Protein Families Druggable Genome, Ion Channels: Other, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.