G3BP (G3BP1) Rabbit Polyclonal Antibody

CAT#: TA331472

Rabbit polyclonal Anti-G3BP Antibody

Product Images

WB Suggested Anti-G3BP Antibody Titration: 2.5ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

• 

  Host: Rabbit; Target Name: G3BP; Sample Tissue: HepG2; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide ; Primary Antibody Concentration:2.5ug/mL; Peptide Concentration: 2.0ug/mL; Lysate Quantity: 25ug/lane; Gel Concentration: 12%

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-G3BP antibody: synthetic peptide directed towards the N terminal of human G3BP. Synthetic peptide located within the following region: EVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: G3BP stress granule assembly factor 1
• Database Link:
  NP_005745
  Entrez Gene 10146 Human
  UniProt ID Q13283
• Background: G3BP is one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
• Synonyms: G3BP; HDH-VIII
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome