Yod1 Rabbit Polyclonal Antibody

CAT#: TA331556

Rabbit Polyclonal Anti-Yod1 Antibody

Product Images

Host: Rabbit; Target Name: Yod1; Sample Tissue: Mouse Spleen lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Yod1 Antibody is: synthetic peptide directed towards the N-terminal region of MOUSE Yod1. Synthetic peptide located within the following region: VPQSEAGTKAGPAGGRPADTMWRVRCKAKGGTHLLQGLSSRTRLRELQGQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: YOD1 OTU deubiquitinating enzyme 1 homologue (S. cerevisiae)
• Database Link:
  NP_848806
  Entrez Gene 226418 Mouse
  UniProt ID Q8CB27
• Background: Hydrolase that can remove conjugated ubiquitin from proteins and participates in endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal proteins. Yod1 may act by triming the ubiquitin chain on the associated substrate to facilitate their threading through the VCP/p97 pore. Ubiquitin moieties on substrates may present a steric impediment to the threading process when the substrate is transferred to the VCP pore and threaded through VCP's axial channel. Yod1 mediates deubiquitination of both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. It is able to cleave both polyubiquitin and di-ubiquitin.
• Synonyms: DKFZp451J1719; DUBA-8; DUBA8; HIN-7; HIN7; HsHIN7; OTUD2; PRO0907
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Mouse: 85%; Zebrafish: 79%