IFNE1 (IFNE) Rabbit Polyclonal Antibody

CAT#: TA331574

Rabbit Polyclonal Anti-IFNE Antibody

Product Images

Host: Rabbit; Target Name: IFNE; Sample Tissue: Fetal Heart lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-IFNE Antibody is: synthetic peptide directed towards the middle region of Human IFNE. Synthetic peptide located within the following region: IFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: interferon, epsilon
• Database Link:
  NP_795372
  Entrez Gene 338376 Human
  UniProt ID Q86WN2
• Background: The function of this protein remains unknown.
• Synonyms: IFN-E; IFNE1; IFNT1; INFE1; PRO655
• Note: Immunogen sequence homology: Human: 100%; Bovine: 93%; Pig: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway, RIG-I-like receptor signaling pathway