CLEC14A Rabbit Polyclonal Antibody

CAT#: TA331583

Rabbit Polyclonal Anti-CLEC14A Antibody

Product Images

Host: Rabbit; Target Name: CLEC14A; Sample Tissue: Fetal Brain lysates; Antibody Dilution: 0.25ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CLEC14A Antibody is: synthetic peptide directed towards the C-terminal region of Human CLEC14A. Synthetic peptide located within the following region: SQPRKESMGPPGLESDPEPAALGSSSAHCTNNGVKVGDCDLRDRAEGALL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: C-type lectin domain family 14 member A
• Database Link:
  NP_778230
  Entrez Gene 161198 Human
  UniProt ID Q86T13
• Background: This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. This family member plays a role in cell-cell adhesion and angiogenesis. It functions in filopodia formation, cell migration and tube formation. Due to its presence at higher levels in tumor endothelium than in normal tissue endothelium, it is considered to be a candidate for tumor vascular targeting.
• Synonyms: C14orf27; CEG1; EGFR-5
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%

Reference Data

• Protein Families: Transmembrane