NSUN5 Rabbit Antibody

CAT#: TA331632

Rabbit Polyclonal Anti-NSUN5 Antibody

Specifications

Product Data

• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Immunogen: The immunogen for Anti-NSUN5 Antibody is: synthetic peptide directed towards the C-terminal region of Human NSUN5. Synthetic peptide located within the following region: ASPETTLSSGFFVAVIERVEVPSSASQAKASAPERTPSPAPKRKKRQQRA
• Formulation: Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Database Link:
  NP_683759
  Entrez Gene 55695 Human
• Background: This gene encodes a member of the evolutionarily conserved NOL1/NOP2/Sun domain family. The encoded protein may function as a DNA methyltransferase in the nucleus. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
• Synonyms: NOL1; NOL1R; NSUN5A; p120; p120(NOL1); WBSCR20; WBSCR20A
• Note: Immunogen sequence homology: Human: 100%