FAM117A Rabbit Polyclonal Antibody

CAT#: TA331707

Rabbit Polyclonal Anti-FAM117A Antibody

Product Images

Host: Rabbit; Target Name: FAM117A; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/ml. FAM117A is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FAM117A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM117A. Synthetic peptide located within the following region: SPRPNHSYIFKREPPEGCEKVRVFEEATSPGPDLAFLTSCPDKNKVHFNP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: family with sequence similarity 117 member A
• Database Link:
  NP_110429
  Entrez Gene 81558 Human
  UniProt ID Q9C073
• Background: The function of this protein remains unknown.
• Synonyms: C; EBP-induced protein; EBP induced protein; family with sequence similarity 117; member A
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Zebrafish: 93%; Dog: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%