Nucleotide binding protein like (NUBPL) Rabbit Polyclonal Antibody

CAT#: TA331720

Rabbit Polyclonal Anti-NUBPL Antibody

Product Images

Host: Rabbit; Target Name: NUBPL; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NUBPL Antibody is: synthetic peptide directed towards the N-terminal region of Human NUBPL. Synthetic peptide located within the following region: MGIWQRLLLFGGVSLRAGGGATAPLGGSRAMVCGRQLSGAGSETLKQRRT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: nucleotide binding protein like
• Database Link:
  NP_079428
  Entrez Gene 80224 Human
  UniProt ID Q8TB37
• Background: This gene encodes a member of the Mrp/NBP35 ATP-binding proteins family. The encoded protein is required for the assembly of the respiratory chain NADH dehydrogenase (complex I), an oligomeric enzymatic complex located in the inner mitochondrial membrane. The respiratory complex I consists of 45 subunits and 8 iron-sulfur (Fe/S) clusters. This protein is an Fe/S protein that plays a critical role in the assembly of respiratory complex I, likely by transferring Fe/S into the Fe/S-containing complex I subunits. Mutations in this gene cause mitochondrial complex I deficiency. Alternatively spliced transcript variants encoding distinct isoforms have been identified.
• Synonyms: C14orf127; huInd1; IND1
• Note: Immunogen sequence homology: Human: 100%; Horse: 93%; Bovine: 92%; Pig: 86%; Guinea pig: 86%; Dog: 85%; Rat: 85%; Rabbit: 85%; Mouse: 83%