EPS15R (EPS15L1) Rabbit Polyclonal Antibody

CAT#: TA331793

Rabbit Polyclonal Anti-EPS15L1 Antibody

Product Images

Host: Rabbit; Target Name: EPS15L1; Sample Tissue: Placenta lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-EPS15L1 Antibody is: synthetic peptide directed towards the C-terminal region of Human EPS15L1. Synthetic peptide located within the following region: GFSDDPFKSKQDTPALPPKKPAPPRPKPPSGKSTPVSQLGSADFPEAPDP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 95 kDa
• Gene Name: epidermal growth factor receptor pathway substrate 15 like 1
• Database Link:
  NP_067058
  Entrez Gene 58513 Human
  UniProt ID Q9UBC2
• Background: EPS15L1 seems to be a constitutive component of clathrin-coated pits that is required for receptor-mediated endocytosis.
• Synonyms: EPS15R
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome