CORO1B Rabbit Polyclonal Antibody

CAT#: TA331827

Rabbit Polyclonal Anti-CORO1B Antibody

Product Images

Host: Rabbit; Target Name: CORO1B; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CORO1B Antibody is: synthetic peptide directed towards the C-terminal region of Human CORO1B. Synthetic peptide located within the following region: STTTAADATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: coronin 1B
• Database Link:
  NP_065174
  Entrez Gene 57175 Human
  UniProt ID Q9BR76
• Background: Members of the coronin family, such as CORO1B, are WD repeat-containing actin-binding proteins that regulate cell motility.
• Synonyms: CORONIN-2
• Note: Immunogen sequence homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%; Bovine: 79%