C9orf167 (TOR4A) Rabbit Polyclonal Antibody

CAT#: TA331887

Rabbit Polyclonal Anti-TOR4A Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "TOR4A"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-TOR4A Antibody is: synthetic peptide directed towards the C-terminal region of Human TOR4A. Synthetic peptide located within the following region: QYHARHHCPEARAAQDCREELARRVADVVARAEAEEKTPLLVLDDVELMP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 47 kDa
Gene Name torsin family 4 member A
Background The function of this protein remains unknown.
Synonyms C9orf167
Note Immunogen sequence homology: Pig: 100%; Human: 100%; Dog: 92%; Horse: 92%; Rat: 86%; Bovine: 83%; Guinea pig: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.