ARL6IP4 Rabbit Polyclonal Antibody

CAT#: TA331903

Rabbit Polyclonal Anti-ARL6IP4 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ARL6IP4"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ARL6IP4 Antibody is: synthetic peptide directed towards the middle region of Human ARL6IP4. Synthetic peptide located within the following region: SSSSSSDGRKKRGKYKDKRRKKKKKRKKLKKKGKEKAEAQQVEALPGPSL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 25 kDa
Gene Name ADP ribosylation factor like GTPase 6 interacting protein 4
Background The function of this protein remains unknown.
Synonyms SFRS20; SR-25; SRp25; SRrp37
Note Immunogen sequence homology: Human: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Rat: 80%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.