C1RL Rabbit Polyclonal Antibody

CAT#: TA331909

Rabbit Polyclonal Anti-C1RL Antibody

Product Images

WB Suggested Anti-C1RL Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-C1RL Antibody is: synthetic peptide directed towards the middle region of Human C1RL. Synthetic peptide located within the following region: KVQNHCQEPYYQAAAAGALTCATPGTWKDRQDGEEVLQCMPVCGRPVTPI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: complement C1r subcomponent like
• Database Link:
  NP_057630
  Entrez Gene 51279 Human
  UniProt ID Q9NZP8
• Background: C1RL mediates the proteolytic cleavage of HP/haptoglobin in the endoplasmic reticulum.
• Synonyms: C1r-LP; C1RL1; C1RLP; CLSPa
• Note: Immunogen sequence homology: Human: 100%; Mouse: 90%

Reference Data

• Protein Families: Druggable Genome, Protease