IST1 Rabbit Polyclonal Antibody
Other products for "IST1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-IST1 Antibody is: synthetic peptide directed towards the C-terminal region of Human IST1. Synthetic peptide located within the following region: TDLIDVGFTDDVKKGGPGRGGSGGFTAPVGGPDGTVPMPMPMPMPSANTP |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 36 kDa |
Gene Name | IST1, ESCRT-III associated factor |
Database Link | |
Background | IST1 is proposed to be involved in specific functions of the ESCRT machinery. It is required for efficient abscission during cytokinesis, but not for HIV-1 budding. The involvment in the MVB pathway is not established. IST1 is involved in recruiting VPS4A and/or VPS4B to the midbody of dividing cells. |
Synonyms | OLC1 |
Note | Immunogen sequence homology: Human: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Pig: 92%; Horse: 92%; Guinea pig: 92%; Dog: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.