GCDH Rabbit Polyclonal Antibody

CAT#: TA331987

Rabbit Polyclonal Anti-Gcdh Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "GCDH"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Gcdh Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LQLGRLKDQDKATPEMVSLLKRNNCGKALDIARQARDILGGNGISDEYHV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 49 kDa
Gene Name glutaryl-CoA dehydrogenase
Background The function of this protein remains unknown.
Synonyms ACAD5; GCD
Note Immunogen sequence homology: Human: 100%; Bovine: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 92%; Pig: 86%; Guinea pig: 85%; Zebrafish: 79%
Reference Data
Protein Families Druggable Genome
Protein Pathways Fatty acid metabolism, Lysine degradation, Metabolic pathways, Tryptophan metabolism

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.