PMF1 Rabbit Polyclonal Antibody

CAT#: TA332013

Rabbit Polyclonal Anti-PMF1 Antibody

Product Images

WB Suggested Anti-PMF1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Transfected 293T

• 

  Human Stomach

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PMF1 Antibody: synthetic peptide directed towards the middle region of human PMF1. Synthetic peptide located within the following region: TDCYKCFYQLQPAMTQQIYDKFIAQLQTSIREEISDIKEEGNLEAVLNAL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 19 kDa
• Gene Name: polyamine-modulated factor 1
• Database Link:
  NP_009152
  Entrez Gene 11243 Human
• Background: PMF1 is part of the MIS12 complex which is required for normal chromosome alignment and segregation and kinetochore formation during mitosis. It may act as a cotranscription partner of NFE2L2 involved in regulation of polyamine-induced transcription of SSAT.
• Synonyms: Est1p-like protein B (EST1B); OTTHUMP00000016581; polyamine-modulated factor 1
• Note: Immunogen sequence homology: Goat: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Pig: 86%; Horse: 86%; Guinea pig: 86%; Bovine: 79%; Rabbit: 79%

Reference Data

• Protein Families: Stem cell - Pluripotency