BTN2A2 Rabbit Polyclonal Antibody

CAT#: TA332019

Rabbit Polyclonal Anti-BTN2A2 Antibody

Product Images

Host: Rabbit; Target Name: BTN2A2; Sample Tissue: Fetal Heart lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-BTN2A2 Antibody is: synthetic peptide directed towards the N-terminal region of Human BTN2A2. Synthetic peptide located within the following region: EDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: butyrophilin subfamily 2 member A2
• Database Link:
  NP_008926
  Entrez Gene 10385 Human
  UniProt ID Q8WVV5
• Background: Butyrophilin is the major protein associated with fat droplets in the milk. This gene is a member of the BTN2 subfamily of genes, which encode proteins belonging to the butyrophilin protein family. The gene is located in a cluster on chromosome 6, consisting of seven genes belonging to the expanding B7/butyrophilin-like group, a subset of the immunoglobulin gene superfamily. The encoded protein is a type I receptor glycoprotein involved in lipid, fatty-acid and sterol metabolism. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Synonyms: BT2.2; BTF2; BTN2.2
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane