Kindlin 2 (FERMT2) Rabbit Polyclonal Antibody

CAT#: TA332020

Rabbit Polyclonal Anti-FERMT2 Antibody

Product Images

Host: Rabbit; Target Name: FERMT2; Sample Tissue: HT1080 Whole Cell lysates; Antibody Dilution: 1.0ug/ml. FERMT2 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FERMT2 Antibody is: synthetic peptide directed towards the C-terminal region of Human FERMT2. Synthetic peptide located within the following region: TSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 75 kDa
• Gene Name: fermitin family member 2
• Database Link:
  NP_006823
  Entrez Gene 10979 Human
  UniProt ID Q96AC1
• Background: FERMT2 participates in the connection between ECM adhesion sites and the actin cytoskeleton and also in the orchestration of actin assembly and cell shape modulation. It recruits migfilin (FBLP1) protein to cell-ECM focal adhesion sites.
• Synonyms: KIND2; mig-2; MIG2; PLEKHC1; UNC112; UNC112B
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 93%; Guinea pig: 93%; Zebrafish: 79%