Influenza Virus NS1A Binding Protein (IVNS1ABP) Rabbit Polyclonal Antibody

CAT#: TA332036

Rabbit Polyclonal Anti-IVNS1ABP Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "IVNS1ABP"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-IVNS1ABP Antibody: synthetic peptide directed towards the N terminal of human IVNS1ABP. Synthetic peptide located within the following region: MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 72 kDa
Gene Name influenza virus NS1A binding protein
Background IVNS1ABP is a novel human protein that interacts with the influenza A virus. Nonstructural NS1 protein is relocalized in the nuclei of infected cells.
Synonyms FLARA3; HSPC068; KLHL39; ND1; NS-1; NS1-BP; NS1BP
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 77%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.