ZNF192 (ZKSCAN8) Rabbit Polyclonal Antibody

CAT#: TA332039

Rabbit Polyclonal Anti-ZNF192 Antibody

Product Images

WB Suggested Anti-ZNF192 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF192 Antibody: synthetic peptide directed towards the N terminal of human ZNF192. Synthetic peptide located within the following region: PSPPDQTPEEDLVIVKVEEDHGWDQESSLHESNPLGQEVFRLRFRQLRYQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 66 kDa
• Gene Name: zinc finger with KRAB and SCAN domains 8
• Database Link:
  NP_006289
  Entrez Gene 7745 Human
  UniProt ID Q15776
• Background: ZNF192 belongs to the krueppel C2H2-type zinc-finger protein family and contains the conserved SCAN box domain. ZNF192 may be involved in transcriptional regulation.
• Synonyms: LD5-1; ZNF192; ZSCAN40
• Note: Immunogen sequence homology: Human: 100%; Dog: 79%; Pig: 79%; Goat: 79%; Horse: 79%; Bovine: 79%

Reference Data

• Protein Families: Transcription Factors