FARSLB (FARSB) Rabbit Polyclonal Antibody

CAT#: TA332058

Rabbit Polyclonal Anti-FARSB Antibody

Product Images

Host: Rabbit; Target Name: FARSB; Sample Tissue: 293T Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FARSB Antibody is: synthetic peptide directed towards the N-terminal region of Human FARSB. Synthetic peptide located within the following region: EEFDELCFEFGLELDEITSEKEIISKEQGNVKAAGASDVVLYKIDVPANR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: phenylalanyl-tRNA synthetase beta subunit
• Database Link:
  NP_005678
  Entrez Gene 10056 Human
  UniProt ID Q9NSD9
• Background: This gene encodes a highly conserved enzyme that belongs to the aminoacyl-tRNA synthetase class IIc subfamily. This enzyme comprises the regulatory beta subunits that form a tetramer with two catalytic alpha subunits. In the presence of ATP, this tetramer is responsible for attaching L-phenylalanine to the terminal adenosine of the appropriate tRNA. A pseudogene located on chromosome 10 has been identified.
• Synonyms: FARSLB; FRSB; HSPC173; PheHB; PheRS
• Note: Immunogen sequence homology: Human: 100%; Rat: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Goat: 86%; Bovine: 86%; Guinea pig: 79%

Reference Data

• Protein Pathways: Aminoacyl-tRNA biosynthesis