DRIL1 (ARID3A) Rabbit Polyclonal Antibody

CAT#: TA332067

Rabbit Polyclonal Anti-ARID3A Antibody

Product Images

WB Suggested Anti-ARID3A Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysateARID3A is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ARID3A Antibody: synthetic peptide directed towards the middle region of human ARID3A. Synthetic peptide located within the following region: QAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: AT-rich interaction domain 3A
• Database Link:
  NP_005215
  Entrez Gene 1820 Human
  UniProt ID Q99856
• Background: ARID3A is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.This gene is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. It was found by its homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.
• Synonyms: BRIGHT; DRIL1; DRIL3; E2FBP1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Horse: 92%; Guinea pig: 92%; Zebrafish: 77%

Reference Data

• Protein Families: Transcription Factors