AP4M1 Rabbit Polyclonal Antibody

CAT#: TA332088

Rabbit Polyclonal Anti-AP4M1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "AP4M1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-AP4M1 Antibody is: synthetic peptide directed towards the C-terminal region of Human AP4M1. Synthetic peptide located within the following region: QELSSPEQKAELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 50 kDa
Gene Name adaptor related protein complex 4 mu 1 subunit
Background This gene encodes a subunit of the heterotetrameric AP-4 complex. The encoded protein belongs to the adaptor complexes medium subunits family. This AP-4 complex is involved in the recognition and sorting of cargo proteins with tyrosine-based motifs from the trans-golgi network to the endosomal-lysosomal system.
Synonyms CPSQ3; MU-4; MU-ARP2; SPG50
Note Immunogen sequence homology: Human: 100%; Rat: 93%; Goat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Mouse: 86%; Guinea pig: 86%
Reference Data
Protein Pathways Lysosome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.