Ccdc167 Rabbit Polyclonal Antibody

CAT#: TA332167

Rabbit Polyclonal Anti-Ccdc167 Antibody

Product Images

Host: Rabbit; Target Name: Ccdc167; Sample Tissue: Mouse Small Intestine lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-1110021J02Rik Antibody is: synthetic peptide directed towards the middle region of Mouse 1110021J02Rik. Synthetic peptide located within the following region: MTKKKRENLGVAQEIDGLEEKLSRCRKDLEAVTSQLYRAELSPEDRRSLE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 11 kDa
• Gene Name: coiled-coil domain containing 167
• Database Link:
  NP_001157213
  Entrez Gene 68597 Mouse
  UniProt ID Q9D162
• Background: The function of this protein remains unknown.
• Synonyms: C6orf129; HSPC265
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Rat: 92%; Mouse: 92%; Bovine: 86%; Guinea pig: 86%