KCTD1 Rabbit Polyclonal Antibody

CAT#: TA332184

Rabbit Polyclonal Anti-KCTD1 Antibody

Product Images

Host: Rabbit; Target Name: KCTD1; Sample Tissue: MCF7 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-KCTD1 Antibody is: synthetic peptide directed towards the C-terminal region of Human KCTD1. Synthetic peptide located within the following region: NHDSTHVIRFPLNGYCHLNSVQVLERLQQRGFEIVGSCGGGVDSSQFSEY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 95 kDa
• Gene Name: potassium channel tetramerization domain containing 1
• Database Link:
  NP_001136202
  Entrez Gene 284252 Human
  UniProt ID Q719H9
• Background: KCTD1 may repress the transcriptional activity of AP-2 family members, including TFAP2A, TFAP2B and TFAP2C to various extent.
• Synonyms: C18orf5; SENS
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Ion Channels: Other