Taco1 Rabbit Polyclonal Antibody

CAT#: TA332197

Rabbit Polyclonal Anti-Taco1 Antibody

Product Images

Host: Rabbit; Target Name: Taco1; Sample Tissue: Rat Liver lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Taco1 Antibody is: synthetic peptide directed towards the middle region of Rat Taco1. Synthetic peptide located within the following region: AVAFAGHNKWSKVRHIKGPKDMERSRIFSKLTLSIRLAVKEGGPNPENNS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: translational activator of cytochrome c oxidase I
• Database Link:
  NP_001101772
  Entrez Gene 360645 Rat
  UniProt ID B2RYT9
• Background: Taco1 acts as a translational activator of mitochondrially-encoded cytochrome c oxidase 1.
• Synonyms: CCDC44
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 86%