LILRB5 Rabbit Polyclonal Antibody

CAT#: TA332214

Rabbit Polyclonal Anti-LILRB5 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "LILRB5"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-LILRB5 Antibody is: synthetic peptide directed towards the C-terminal region of Human LILRB5. Synthetic peptide located within the following region: RPAGAAGPEPKDQGLQKRASPVADIQEEILNAAVKDTQPKDGVEMDARAA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 53 kDa
Gene Name leukocyte immunoglobulin like receptor B5
Background This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). Several other LIR subfamily B receptors are expressed on immune cells where they bind to MHC class I molecules on antigen-presenting cells and inhibit stimulation of an immune response. Multiple transcript variants encoding different isoforms have been found for this gene.
Synonyms CD85C; LIR-8; LIR8
Note Immunogen sequence homology: Human: 100%; Horse: 77%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.