Fam107b Rabbit Polyclonal Antibody

CAT#: TA332252

Rabbit Polyclonal Anti-Fam107b Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Fam107b"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Fam107b Antibody is: synthetic peptide directed towards the middle region of Rat Fam107b. Synthetic peptide located within the following region: PELQKVMEKRRRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 14 kDa
Gene Name family with sequence similarity 107, member B
Background The function of this protein remains unknown.
Synonyms C10orf45; FLJ45505; MGC11034; MGC90261
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Zebrafish: 87%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.