PCCA Rabbit Polyclonal Antibody

CAT#: TA332364

Rabbit Polyclonal Anti-PCCA Antibody

Product Images

WB Suggested Anti-PCCA Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PCCA Antibody: synthetic peptide directed towards the N terminal of human PCCA. Synthetic peptide located within the following region: LYYSRQCLMVSRNLGSVGYDPNEKTFDKILVANRGEIACRVIRTCKKMGI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 75 kDa
• Gene Name: propionyl-CoA carboxylase alpha subunit
• Database Link:
  NP_000273
  Entrez Gene 5095 Human
  UniProt ID P05165
• Background: PCCA is the alpha subunit of the heterodimeric mitochondrial enzyme Propionyl-CoA carboxylase. PCCA is the biotin-binding region of this enzyme. Mutations in either PCCA or PCCB (encoding the beta subunit) lead to an enzyme deficiency resulting in propionic acidemia.The protein encoded by this gene is the alpha subunit of the heterodimeric mitochondrial enzyme Propionyl-CoA carboxylase. PCCA encodes the biotin-binding region of this enzyme. Mutations in either PCCA or PCCB (encoding the beta subunit) lead to an enzyme deficiency resulting in propionic acidemia. Two transcript variants encoding different isoforms have been found for this gene.
• Synonyms: alpha polypeptide; mitochondrial; PCCase alpha subunit; propanoyl-CoA:carbon dioxide ligase alpha subunit; propionyl-CoA carboxylase alpha chain; propionyl-coenzyme A carboxylase; Propionyl Coenzyme A carboxylase alpha polypeptide
• Note: Immunogen sequence homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Bovine: 86%; Rabbit: 86%; Horse: 83%; Mouse: 77%; Zebrafish: 75%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Propanoate metabolism, Valine, leucine and isoleucine degradation