VSIG1 Rabbit Polyclonal Antibody

CAT#: TA333389

Rabbit Polyclonal Anti-VSIG1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "VSIG1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-VSIG1 Antibody: synthetic peptide directed towards the N terminal of human VSIG1. Synthetic peptide located within the following region: SIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNN
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 42 kDa
Gene Name V-set and immunoglobulin domain containing 1
Background The specific function of this protein remains unknown.
Synonyms 1700062D20Rik; dJ889N15.1; GPA34
Note Immunogen sequence homology: Human: 100%; Pig: 86%; Horse: 79%; Bovine: 79%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.