SOX5 Rabbit Polyclonal Antibody

CAT#: TA333436

Rabbit Polyclonal Anti-SOX5 Antibody

Product Images

WB Suggested Anti-SOX5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Hela cell lysate

• 

  Host: Rabbit; Target Name: SOX5; Sample Tissue: HepG2 cell lysates; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide ; Primary Antibody Concentration:2.0 ug/ml; Peptide Concentration: 0.0ug/ml; Lysate Quantity: 25ug/lane; Gel Concentr

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SOX5 Antibody: synthetic peptide directed towards the C terminal of human SOX5. Synthetic peptide located within the following region: PEPGMPVIQSTYGVKGEEPHIKEEIQAEDINGEIYDEYDEEEDDPDVDYG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: SRY-box 5
• Database Link:
  NP_821078
  Entrez Gene 20678 MouseEntrez Gene 6660 Human
  UniProt ID P35711
• Background: SOX5 encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8.
• Synonyms: L-SOX5; L-SOX5B; L-SOX5F; LAMSHF
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 92%

Reference Data

• Protein Families: Transcription Factors