SUSD3 Rabbit Polyclonal Antibody

CAT#: TA333507

Rabbit Polyclonal Anti-SUSD3 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "SUSD3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-SUSD3 Antibody: synthetic peptide directed towards the N terminal of human SUSD3. Synthetic peptide located within the following region: LRLPPQATFQVLRGNGASVGTVLMFRCPSNHQMVGSGLLTCTWKGSIAEW
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 27 kDa
Gene Name sushi domain containing 3
Background The exact function of SUSD3 remains unknown.
Synonyms MGC26847
Note Immunogen sequence homology: Human: 100%; Pig: 77%; Bovine: 77%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.