RIPPLY1 Rabbit Polyclonal Antibody

CAT#: TA333545

Rabbit Polyclonal Anti-RIPPLY1 Antibody

Product Images

Host: Rabbit; Target Name: RIPPLY1; Sample Tissue: ACHN Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RIPPLY1 Antibody is: synthetic peptide directed towards the middle region of Human RIPPLY1. Synthetic peptide located within the following region: RPWLSSTNDSPRQMRKLVDLAAGGATAAEVTKAESKFHHPVRLFWPKSRS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 16 kDa
• Gene Name: ripply transcriptional repressor 1
• Database Link:
  NP_612391
  Entrez Gene 92129 Human
  UniProt ID Q0D2K3
• Background: This gene encodes a protein similar to a zebrafish protein which acts as a transcriptional repressor in and is required for somite segmentation in zebrafish embryos. Multiple transcript variants encoding different isoforms have been found for this gene.
• Synonyms: ripply1 homolog; ripply1 homolog (zebrafish); RP11-321G1.2
• Note: Immunogen sequence homology: Human: 100%; Rat: 79%; Horse: 79%; Bovine: 79%