SLC26A9 Rabbit Polyclonal Antibody

CAT#: TA333569

Rabbit Polyclonal Anti-SLC26A9 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "SLC26A9"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-SLC26A9 Antibody: synthetic peptide directed towards the middle region of human SLC26A9. Synthetic peptide located within the following region: LAKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGSLECKHVFPSIHD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 87 kDa
Gene Name solute carrier family 26 member 9
Background This gene is one member of a family of sulfate/anion transporter genes. Family members are well conserved in their genomic (number and size of exons) and protein (aa length among species) structures yet have markedly different tissue expression patterns.
Synonyms anion transporter; exchanger-9; member 9; OTTHUMP00000034236; OTTHUMP00000034326; solute carrier family 26
Note Immunogen sequence homology: Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 92%; Bovine: 92%; Rat: 85%; Rabbit: 85%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.