Arylsulfatase J (ARSJ) Rabbit Polyclonal Antibody

CAT#: TA333678

Rabbit Polyclonal Anti-ARSJ Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ARSJ"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ARSJ Antibody is: synthetic peptide directed towards the C-terminal region of Human ARSJ. Synthetic peptide located within the following region: VWGPWYKEETKKKKPSKNQAEKKQKKSKKKKKKQQKAVSGSTCHSGVTCG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 57 kDa
Gene Name arylsulfatase family member J
Background Sulfatases, such as ARSJ, hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules.
Synonyms FLJ23548
Note Immunogen sequence homology: Human: 100%; Dog: 93%; Horse: 86%; Bovine: 85%
Reference Data
Protein Families Druggable Genome, Secreted Protein

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.