WDR18 Rabbit Polyclonal Antibody

CAT#: TA333687

Rabbit Polyclonal Anti-WDR18 Antibody

Product Images

WB Suggested Anti-WDR18 Antibody; Titration: 1.0 ug/ml; Positive Control: Jurkat Whole CellWDR18 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-WDR18 Antibody is: synthetic peptide directed towards the N-terminal region of Human WDR18. Synthetic peptide located within the following region: PMWSCIVWELHSGANLLTYRGGQAGPRGLALLNGEYLLAAQLGKNYISAW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: WD repeat domain 18
• Database Link:
  NP_077005
  Entrez Gene 57418 Human
  UniProt ID Q9BV38
• Background: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.
• Synonyms: Ipi3; R32184_1
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 93%