ACTR8 Rabbit Polyclonal Antibody

CAT#: TA333696

Rabbit Polyclonal Anti-ACTR8 Antibody

Product Images

Host: Rabbit; Target Name: ACTR8; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0 ug/ml.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ACTR8 Antibody is: synthetic peptide directed towards the N-terminal region of Human ACTR8. Synthetic peptide located within the following region: MTQAEKGDTENGKEKGGEKEKEQRGVKRPIVPALVPESLQEQIQSNFIIV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 70 kDa
• Gene Name: ARP8 actin-related protein 8 homolog
• Database Link:
  NP_075050
  Entrez Gene 93973 Human
  UniProt ID Q9H981
• Background: ACTR8 plays an important role in the functional organization of mitotic chromosomes.
• Synonyms: ARP8; hArp8; INO80N
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%