MRPS16 Rabbit Polyclonal Antibody

CAT#: TA333784

Rabbit Polyclonal Anti-MRPS16 Antibody

Product Images

Host: Rabbit; Target Name: MRPS16; Sample Tissue: 293T Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MRPS16 Antibody is: synthetic peptide directed towards the C-terminal region of Human MRPS16. Synthetic peptide located within the following region: EKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 15 kDa
• Gene Name: mitochondrial ribosomal protein S16
• Database Link:
  NP_057149
  Entrez Gene 51021 Human
  UniProt ID Q9Y3D3
• Background: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S16P family. The encoded protein is one of the most highly conserved ribosomal proteins between mammalian and yeast mitochondria. Three pseudogenes (located at 8q21.3, 20q13.32, 22q12-q13.1) for this gene have been described.
• Synonyms: CGI-132; COXPD2; MRP-S16; RPMS16
• Note: Immunogen sequence homology: Human: 100%; Pig: 75%; Rat: 75%; Guinea pig: 75%